Typing tool

Complete norovirus genomes

AB039774  GI.5
 GI.P12

Length: 7,700 | 3 CDS

ORF1: 5..5368
ORF2: 5352..6983
ORF3: 6983..7621
LOCUS       AB039774                7700 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:SzUG1.
ACCESSION   AB039774
VERSION     AB039774.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-terminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7700)
  AUTHORS   Katayama,K. and Kojima,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7700
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="SzUG1"
                     /db_xref="taxon:95340"
     CDS             5..5368
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11812.1"
                     /translation="MMMASKDVVAATAASSNNASDNSNTIKDRLLAKLKNIGSNNKPI
                     KIENTHMALDLIGRGPSPAPPTEPPKQQRDRAPRSVVETQQAMGWVEQPLDQNLPTWE
                     ELSESEKRDILANNENWFDAGGLAPASIPSTHDRGREEGPLGHQVKWTAASGVDLGVV
                     DLTTVNGPAWNMCPMPPMDQRNNGPAKEPIIGDMLEFYEGHIYHYAIYIGQGKSIGVH
                     SPQAAFTIARITIHPIVAWWRVCYTPNAEQRLTYDQLKELENEPWPYAAVTNNCYEFC
                     CQVMGVQDSWLERRLVTSGRFNHPTQDWSKDTPDFQQDSKLEIVRDAVLAAINGLVSK
                     PFKDLLGKLKPLNVLNLLSNCDWTFMGVVETVILLMELFGVFWNPPDVSSFIASLLPD
                     MHLQGPEDLAKDLIPLVLGGIGLAIGFTKDKVTKVMKSAVEGLRAATQLGQYGLEIFA
                     VLKKYFFGGDQTEKTLKDIEAAVIDMEVISATAITQLVRDKQSARTYMAILDAEEEKA
                     RKLSVKHADPHVVSTTNALIARISLARSALAKAQAEMTNRVKPVVIMMCGPPGIGKTK
                     AAEYLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIADDCNKLQA
                     IADTAPLTLNCDRIEKKGLQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYCSA
                     PDVEQTRRTNPGDTGALKDCFKSDFSHLKMELAPQGGFDNQGNTPFGKGTMRPTTLNR
                     LLIQAVALTMERQDEFQMQGPTYDFDADRISAFTSLARANGLGLIDMAKLGKRLRSVD
                     SIHGLKNALSGYSITPCSIKWQARIYDIESDGTTVKIKENTAAQSQQQHSIDTAVLAL
                     TRLRAARAAAYASCLQSAITTILQMAGSALVIHRAVKRMFGTHSSTISLEGPTREHQC
                     RAHVAKANGGGPIGHDDVIDKYGLCETEEEEDTQEVKVCLPTAIQEGKNKGKTKKGRG
                     RRANYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEEMAEVQAGGDGG
                     IGETEMEIRHRVFYKSKSRKNRQEERHQLGLVTGSDIRKRKPIDWTPPKNEWADDNRE
                     VDYNEKINFEAPPTLWSRVVKFGSGWGFWVSPTVFITTTHVIPSGAKEFFGEPIDSIA
                     IHRAGEFTQLRFSKKIRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIAS
                     MKIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRNNDWVVCGVHAAATKSG
                     NTVVCAVQAGEGETTLEGGDKGHYAGHEIIKHSKGPALSSKTKFWRSTTEPLPPGVYE
                     PAYLGGRDPRVKGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSVLEQVMDT
                     PVPWSYADACQSLDKTTSSGHPYHKRKNDDWNGTTFIGELGEQAAHANNMYEQGKSMK
                     PLYTAALKDELVKPEKVYQKIKKRLLWGADLSTVIRAARAFGPFCDAIKPHVIKLPIK
                     VGMNSIEDGPMIYAEHARFKNHFDADYSAWDSTQNRQIMTESFSIMCRLTATPELASV
                     VAKDLLAPSEMDVGDYIIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDVI
                     QSQSYFSFYGDDEIVSTDIDFDPSRLTQVLKEYGLRPTRPDKSEGPIVLRRQIDGLVF
                     LRRTISKDAAGFQGRLDRGSIERQLWWTRGPNHDDPNETLIPHPQRKVQLISLLGEAS
                     LHGEKFYRKIAGKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVND
                     DGV"
     CDS             5352..6983
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11813.1"
                     /translation="MMMASKDATPSADGANGAGQLVPEVNNAEPLPLDPVAGASTALA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRVILAGNAFTAGKVIICCVPPGFQSRTLSIAQATLFPHVIADVRTLEPLEI
                     PLEDVRNTLYHNNDSQPTMRLLCMLYTPLRTGGGSGGTDAFVVAGRVLTCPSPDFNFL
                     FLVPPTVEQKTRPFSVPNIPLQNLSNSRVPSLIQSMVLSNDHAQTVQFQNGRCTTDGH
                     LLGTTPVSAGQLMKFRGKVTSGSKVLNLTELDGSPFLAFEAPAPAGFPDLGKCDWHVE
                     MSLYQDNNHADPIVLHAIEPNSSSFVPHLGSVSFKENVNVAGDYVCTIQYTSPPSDPH
                     NPNADVDFWSIPDYGSNLAEASQLAPVVYPPGFGEAIVYFMSRVPGWNRTNRLNLVPC
                     LLPQEFIGHFVSEQAPAIGEAALLHYVDPDTNRNLGEFKLYPEGFITCVPNGTGPQQL
                     PLNGVFVFSSWVSRFYQLKPVGTASLARGRLGIRR"
     CDS             6983..7621
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11814.1"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQSQRYQQDLTLQQN
                     SFKHDKEMIAYQMEMSNNLLAKNLNTRYSLLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPNSSATTLRSGGFMTVPMPFSSKARAPSTSGSVGMTNPNYGDTMSRVSSWVQS
                     QNSSVRSVSPFHRDALQTVWVTPPGSTSSSSVSSVPRFFNTDRLPLFANRGQ"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcagctact gctgctagca gtaacaatgc
       61 tagtgacaat agtaacacca ttaaggatcg cctattggcg aaacttaaga atataggcag
      121 taacaacaag cctataaaaa tagaaaacac acacatggcg ctagatctca ttggcagggg
      181 gccatctcca gcccccccca ctgagccacc caaacagcaa cgggaccgcg cccccagaag
      241 tgtagtggaa acccagcagg ccatgggttg ggtggaacaa ccactggacc agaacctacc
      301 aacctgggaa gagttgagcg agtccgagaa acgtgacatc ctggctaata atgaaaactg
      361 gtttgatgca ggtggacttg ctccggcatc catccctagc acacatgatc gtggcaggga
      421 agagggtcct ctagggcacc aagtgaagtg gactgctgct tctggtgtgg accttggagt
      481 tgttgatctc acaacagtta acggcccagc ttggaatatg tgcccaatgc cccctatgga
      541 ccaacgcaac aatggccccg cgaaggaacc cataattggt gatatgctgg agttttatga
      601 gggccacatt taccactacg ccatatatat tgggcaggga aaatctattg gggtccattc
      661 accacaagcc gcattcacca tagccagaat aaccatacac cccattgtgg cttggtggcg
      721 agtgtgttac accccaaatg ctgaacaaag attaacctat gaccagctca aggagttgga
      781 gaatgagcca tggccatatg cggcagtgac caacaactgc tatgaattct gttgccaggt
      841 tatgggtgtg caagattctt ggctggagcg ccggttggtg acatccgggc gctttaacca
      901 tccaacccag gattggtcta aagacacacc agattttcag caagatagca aattagaaat
      961 tgttagggat gctgtcttag ctgcaatcaa tggccttgtc tcaaaaccat ttaaagatct
     1021 ccttggaaag ctcaagcccc tcaacgttct gaacttacta tctaactgtg attggacatt
     1081 catgggggtt gttgagactg tgatacttct tatggagctg tttggtgtgt tttggaatcc
     1141 acctgatgtg tcaagcttca tcgcatcact tttgcctgac atgcatttac aaggccctga
     1201 agatcttgca aaggacctca tacccttggt acttggcggt ataggtcttg ccattgggtt
     1261 tacaaaagat aaagtcacaa aggtcatgaa aagtgcagtt gaaggccttc gtgctgcaac
     1321 tcagcttggc caatatggtc ttgagatctt cgcagtcctt aagaagtatt tctttggtgg
     1381 tgaccaaacg gagaagacac ttaaggacat agaggcagca gtgattgata tggaagttat
     1441 ctcagccaca gctataacac aactagtgag agacaaacaa tctgcccgaa catacatggc
     1501 catcctagac gctgaggagg agaaagctag aaagctctct gttaaacatg cagaccctca
     1561 tgtggtgtcc acaaccaatg ccctcattgc acgcatatca ttggccagat cagcattggc
     1621 taaagcacag gccgagatga ctaacagggt taaacctgtg gtcattatga tgtgtggtcc
     1681 accaggcatt ggtaagacga aggccgctga gtatctagcc aagcgcctgg ccaatgagat
     1741 tagaccaggt gggaaggttg gtttggtgcc gcgtgaagca gttgatcatt gggatggtta
     1801 tcatggtgaa gaagttatgt tgtgggatga ttatgggatg tcaaagatag ctgatgactg
     1861 caataagtta caggccattg ctgacacagc acctttaacc ttaaattgtg acaggattga
     1921 aaagaaggga ctccagtttg tgtctgatgc catagtcata accactaacg cccctggccc
     1981 agcacctgtc gattttgtta acctgggacc ggtgtgtcgg cgcgtggact tcctcgttta
     2041 ttgttcagct ccagacgtgg aacagacccg ccgcaccaat ccaggtgaca ctggtgccct
     2101 caaggattgt ttcaaaagcg atttctcaca cctaaagatg gaattggcac cacaaggtgg
     2161 ttttgacaac caaggcaaca caccatttgg gaagggcact atgcgcccaa ccacattgaa
     2221 cagactgctg atacaggctg tggcacttac catggagagg caggatgaat tccaaatgca
     2281 aggccccaca tacgactttg acgctgaccg gatttcagcc ttcactagtc tagctcgtgc
     2341 caatgggctg ggccttatag atatggctaa actagggaaa agactaagga gtgtggactc
     2401 tattcatggc cttaagaatg cactcagtgg ttactctata acaccatgta gcataaaatg
     2461 gcaagctagg atctatgaca ttgaatctga tggtacaaca gtcaaaataa aagaaaacac
     2521 cgcagctcaa tcccagcaac aacattcaat agacacagca gtcctggcat tgacccgctt
     2581 aagagcggca agagcagcag cttatgcctc ttgtttgcaa agcgcaatca ccactatcct
     2641 tcaaatggca ggttcggccc tggtcataca tcgggctgta aaacgaatgt ttggcacgca
     2701 ttcgagcacc atctcattag agggccccac tagagaacac caatgtagag cccacgtcgc
     2761 caaggccaat ggaggtggcc ctatagggca cgatgatgtc atcgataaat atggcctatg
     2821 tgagactgag gaggaagagg acactcagga ggttaaagtt tgtctgccca cggctataca
     2881 agaaggtaag aataaaggga aaaccaaaaa gggaagaggt aggcgtgcca attataatgc
     2941 cttctcaaga agaggcctca gtgatgaaga gtatgaggag tacaagaaga tcagagaaga
     3001 gaagaatggc aactacagca tacaggagta ccttgaggac aggcaacgct atgaagaaga
     3061 aatggctgaa gtccaggctg gtggggatgg tggtattgga gagactgaga tggagatacg
     3121 acatcgcgtg ttctataagt ctaaatccag gaagaaccgt caagaagaac gccaccagtt
     3181 aggccttgtg actggcagtg acattagaaa gaggaaacca attgattgga ccccccctaa
     3241 aaatgaatgg gctgatgaca acagagaagt tgattacaat gagaagatca attttgaggc
     3301 ccccccaaca ttatggagcc gtgttgtcaa atttggctca ggttggggct tttgggttag
     3361 ccctacagtg tttatcacaa ccacccatgt catcccatca ggagctaaag aattctttgg
     3421 cgagcccata gactcaatcg ccatccaccg ggcaggagaa ttcacccaat taaggttttc
     3481 aaagaagatc cgccctgatc tgacggggat ggtcttagaa gaagggtgcc cagaaggagt
     3541 ggtctgttcc atactcatca aaagggactc tggtgagttg ctccccctgg ctgttcgtat
     3601 gggggccatt gcttcaatga agatacaggg gcgactagtc catggtcaat ctggtatgtt
     3661 gctcactggg gccaatgcta aaggtatgga cctgggtacc atcccaggtg attgtggtgc
     3721 cccttatgtc tacaaaagaa ataatgactg ggtagtctgt ggtgtacatg ccgcagccac
     3781 aaagtctggc aacacagtgg tgtgtgcggt gcaagctggt gagggtgaga caactttgga
     3841 aggtggtgat aaaggccact acgctggaca tgaaataata aaacacagca aaggaccagc
     3901 tctctcgagc aagactaagt tctggaggtc tacaactgaa ccattaccac caggcgtgta
     3961 cgagccagcc taccttggag gtcgtgaccc tagggtgaaa ggcgggccgt cactgcaaca
     4021 ggttctaaga gaccaactga agccattcgc tgaaccacgg gggcgcatgc cagaacctgg
     4081 attgttggaa gcagctgttg aaactgtgac atctgtctta gaacaagtca tggacacacc
     4141 agtgccctgg tcatatgctg atgcttgtca gtctcttgat aaaaccacca gttctggcca
     4201 tccctatcac aagaggaaga atgatgattg gaatggaacc accttcattg gggagttggg
     4261 tgagcaggct gcccatgcta acaacatgta tgagcagggg aaatcaatga agcctctcta
     4321 cactgctgca ctcaaagatg aattagttaa gcctgaaaaa gtctaccaga agatcaagaa
     4381 gcgcctccta tggggggctg acctgtctac agtcatccga gcggccagag ctttcggtcc
     4441 attctgtgat gccataaagc cacatgtaat aaaattgccc atcaaagttg gcatgaactc
     4501 aattgaagat ggcccaatga tatatgctga gcatgcccga ttcaaaaatc actttgatgc
     4561 tgattattct gcctgggatt caacacaaaa cagacaaatc atgacagagt ctttttcaat
     4621 aatgtgccgc ctgacagcaa caccagaatt ggcttcggtg gtcgccaagg atctccttgc
     4681 accttctgag atggatgttg gggactatat aataagagtc aaagaaggat taccatcagg
     4741 attcccttgt acttctcaag tcaatagcat aaaccactgg ctcatcactc tctgtgcact
     4801 ctctgaggtc acgggccttt ccccagatgt catacagtca caatcttact tttcctttta
     4861 tggggatgac gagatagtat caactgatat tgatttcgac ccatcccgct taacccaggt
     4921 gcttaaagag tatggtcttc ggcccacacg ccctgacaaa agtgaaggac caatagtgtt
     4981 gagaaggcag atcgatggct tggttttcct gagaagaaca atatcaaagg atgcagctgg
     5041 ttttcaaggc aggttggaca ggggctccat cgagagacaa ctgtggtgga cccgcggccc
     5101 aaatcatgat gacccaaatg aaaccctgat accccaccca caaagaaagg ttcagcttat
     5161 atctctgctt ggtgaggcct cactacatgg ggaaaagttt tacaggaaga tagctggtaa
     5221 ggttatccag gaaattaaga ctggtggtct tgaaatgtac gtgccgggtt ggcaggcaat
     5281 gttccgctgg atgcgcttcc atgatctcgg gttgtggaca ggagatcgca atctcctgcc
     5341 cgaattcgta aatgatgatg gcgtctaagg acgctacacc aagcgcagat ggcgcgaacg
     5401 gcgccggtca gctcgtgccg gaggttaata atgctgaacc actgcctctt gatcctgtgg
     5461 ctggggcttc tactgcctta gctactgctg gtcaagttaa tatgattgat ccttggattt
     5521 tcaataactt tgtccaagcc cctcagggtg aatttacaat ctcccctaat aatacccccg
     5581 gtgatatatt atttgatttg caattgggac ctcacctcaa tcccttcctt gcccatttgt
     5641 cacaaatgta taatggttgg gttggtaaca tgcgagtcag ggtcatcctg gcaggtaacg
     5701 catttaccgc cggtaaagtg ataatttgct gtgtcccccc tggcttccaa tctaggaccc
     5761 tatcaattgc tcaggccacc ctctttcctc atgtgattgc tgatgttcgc acattggaac
     5821 cacttgaaat cccattggag gatgttagaa atacactgta ccataacaat gacagccagc
     5881 cgacaatgcg tttattgtgc atgctgtaca cgccacttcg cactggtggt ggttctggtg
     5941 gcacagacgc gtttgtcgtc gcagggagag ttttaacttg cccaagtcct gacttcaact
     6001 ttctcttcct ggtccccccg actgtggaac aaaagacacg cccttttagt gtacccaata
     6061 tcccactcca gaatctttcc aactcccgag ttcctagtct gatccaaagc atggtcctct
     6121 ctaatgacca tgcacaaaca gtccaattcc agaatggcag gtgtactact gacggtcacc
     6181 tgctggggac cacccccgtt tctgctggcc agctcatgaa attcagaggt aaggtaactt
     6241 caggttcaaa agtgctaaac ctaacagaac tagatggttc accatttcta gcctttgagg
     6301 ccccagcccc tgctggattc cccgaccttg gaaagtgtga ttggcatgtc gagatgagtc
     6361 tttatcagga taacaatcat gcagacccta ttgtgctgca tgccattgaa cccaattcat
     6421 cttcctttgt tccgcacctt ggcagtgttt cctttaaaga aaatgttaat gtagctggtg
     6481 attatgtttg tactatacaa tatacttcac ccccctctga tccccataac cctaatgctg
     6541 atgttgattt ctggtctatc cctgattatg gttccaactt ggctgaagca tcacagcttg
     6601 ccccagttgt ctatccccct ggttttggtg aggctattgt ctatttcatg tcacgcgtcc
     6661 ccggctggaa taggaccaac aggctcaatc tggtcccttg cctgttgcct caagagttca
     6721 ttggacattt cgtcagtgaa caagcccccg caattggtga ggccgccctc ttacattatg
     6781 ttgatccaga taccaatcgg aacctgggtg aatttaaatt gtatcctgag ggtttcatca
     6841 cttgtgtccc taatggcact ggccctcagc agcttcccct aaatggtgtc tttgtctttt
     6901 cttcctgggt gtcaagattt tatcaactca agcctgtggg aacggcttct ttagccagag
     6961 gtaggcttgg catcaggaga taatggccca agctataatt ggtgctattg cagcctccgc
     7021 tgctggcagt gcccttggag ctggtatcca agccggcgca gaagcagcac ttcaaagtca
     7081 aaggtatcag caagatttga ccttacagca aaattcattt aaacatgata aagagatgat
     7141 tgcctatcaa atggaaatgt ccaataattt gcttgctaag aatcttaata ctcgctattc
     7201 attgctccag gccggcggcc tgtctagtgc tgatgctgct agggcggtcg ctggcgctcc
     7261 tgtgactcgc atcgttgatt ggaatggcac taggattgca gccccgaatt catcagcaac
     7321 aaccttaaga tcagggggct tcatgactgt gccaatgcca ttcagcagca aggctagggc
     7381 accaagcact tcagggtctg ttggcatgac taatccaaat tacggtgaca ctatgtcccg
     7441 tgtctcctct tgggtacaat cacaaaattc ttcagtaaga agtgtttccc cttttcaccg
     7501 tgatgccctt caaactgtat gggtaacacc accgggttca acttcttctt catctgtatc
     7561 ttctgtacct agatttttca atactgatag attgcctctt ttcgcaaata gaggccaata
     7621 atgttgtaat aagaatgtgg gcatcttatt cagaattaga taattttaat tggaatttaa
     7681 taatttggat aattgatgtt
//